If you have been reading about creatinine and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.
Last reviewed on 2026-01-19. Where a claim depends on a specific study, the study is described rather than over-claimed.
Regulatory treatment of creatine monohydrate varies by country and intended use. In some jurisdictions it is sold as a dietary supplement, while in others it may be treated as a food ingredient or a pharmaceutical raw material. Pharmacopeial monographs, where available, define identification, assay limits, and impurity thresholds. Manufacturers often follow these monographs or internal specifications to ensure batch-to-batch consistency. Analytical method validation is important because different methods can yield different apparent purity values if sample preparation or detection conditions are not controlled.
Quality control for creatine monohydrate begins with identity confirmation and assay determination. Laboratories commonly use high-performance liquid chromatography with ultraviolet detection, often after derivatization or using a suitable column, to quantify creatine. Karl Fischer titration measures water content, which helps verify the monohydrate stoichiometry. Additional tests screen for heavy metals, residual solvents, and microbial contamination depending on the intended use. These tests establish composition and purity rather than biological effect.
Stability studies examine how creatine monohydrate changes under controlled temperature and humidity. The solid is generally stable when kept dry, but moisture can promote hydrolysis to creatinine, especially in solution or at elevated temperatures. Color, odor, and assay values are monitored over time to detect degradation. Because degradation pathways depend on storage conditions, shelf-life claims should specify the tested packaging, temperature, and humidity. Open questions remain about the long-term behavior of different crystal habits and particle sizes.
In the body, creatine is synthesized from arginine, glycine, and methionine, mainly in the liver and kidneys, and is also obtained from foods such as meat and fish. About 95% of body creatine is stored in skeletal muscle, where a fraction is phosphorylated to phosphocreatine. Phosphocreatine serves as a rapid reserve of high-energy phosphate for short bursts of ATP regeneration. The monohydrate form supplies creatine after dissolution and absorption, but it is not itself the active phosphorylated species.
Creatine was first identified in skeletal muscle extracts in the nineteenth century, and its role in phosphagen energy buffering was clarified in the twentieth century. The monohydrate salt became widely studied after methods for inexpensive synthesis and crystallization were developed. Modern research examines its effects on muscle energetics, recovery, and cognitive performance under specific conditions. Findings vary with population, exercise protocol, baseline creatine status, and measurement method. Studies often compare supplementation with placebo during controlled training or testing schedules.
Creatine monohydrate is a hydrated form of creatine, a nitrogen-containing compound involved in cellular energy metabolism. Its molecular formula is C4H9N3O2·H2O, with a molar mass around 149.15 g/mol. The monohydrate is the most common solid form used in research and commercial settings because it crystallizes readily and remains stable under ordinary conditions. The term monohydrate indicates one water molecule per creatine molecule in the crystal lattice. It appears as a white crystalline powder with low odor.
| Property | Value | Notes |
|---|---|---|
| Common synonyms | Creatine hydrate; N-carbamimidoyl-N-methylglycine monohydrate | Synonyms vary by naming convention |
| Typical assay method | HPLC-UV | Often paired with a reference standard |
| Water content method | Karl Fischer titration | Confirms monohydrate stoichiometry |
| Degradation product | Creatinine | Forms more readily in solution and with heat |
| Typical storage temperature | 15–25 °C | Keep dry and away from direct sunlight |
Commercial creatine monohydrate is produced mainly by chemical synthesis rather than extraction from animal tissue. Suppliers provide a certificate of analysis listing assay, water content, and impurity limits, and some products undergo third-party testing. Verification of identity can use infrared or Raman spectroscopy alongside chromatographic methods. Storage recommendations generally call for a cool, dry place and a tightly closed container to limit moisture uptake. Open questions include how packaging, flavoring agents, and long-term storage affect the stability of finished products.
Dry creatine monohydrate is generally stable when kept sealed and protected from heat and moisture. In solution, however, creatine undergoes a slow cyclization to creatinine, a related compound with no role in phosphocreatine storage. The rate of this conversion increases with temperature and is influenced by pH. Because creatinine is a common impurity in liquid or poorly stored products, analytical testing often measures both compounds. The crystalline monohydrate is less prone to degradation than aqueous preparations, though caking can occur if moisture enters the container.
Tens of thousands of three-dimensional protein structures have been determined by X-ray crystallography and protein nuclear magnetic resonance spectroscopy (protein NMR) and a central question in structural bioinformatics is whether it is practical to predict possible protein–protein interactions only based on these 3D shapes, without performing protein–protein interaction experiments. A variety of methods have been developed to tackle the protein–protein docking problem, though it seems that there is still much work to be done in this field. Other interactions encountered in the field include Protein–ligand (including drug) and protein–peptide. Molecular dynamic simulation of movement of atoms about rotatable bonds is the fundamental principle behind computational algorithms, termed docking algorithms, for studying molecular interactions.
Cilengitide, a cyclic pentapeptide (RGDfV), is an investigational drug intended to block the growth of new blood vessels in tumors by interfering with the activation of integrin αVβ3. This integrin is upregulated in tumor and activated endothelial cells. This and other anti-angiogenic therapies depend on cutting off the blood supply to the tumor micro-environment, leading to hypoxia and necrosis. Cilengitide has been evaluated for the treatment of glioblastoma, but, as is the case for other anti-angiogenic therapies, has not been shown to alter progression or improve survival either alone or in combination with standard treatments. CEND-1, also known as iRGD, is a cyclic peptide that homes to tumors via binding to integrin alpha V receptors. It also binds and activates neuropilin-1, leading to a temporary opening of the tumor and an enhanced delivery of anti-cancer agents into the tumor tissue. It is currently being tested in clinical trials in solid tumor patients.
Agouti signalling peptide adopts an inhibitor cystine knot motif. Along with the homologous Agouti-related peptide, these are the only known mammalian proteins to adopt this fold. The peptide consists of 131 amino acids. The lethal yellow mutation (Ay) was the first embryonic mutation to be characterized in mice, as homozygous lethal yellow mice (Ay/ Ay) die early in development, due to an error in trophectoderm differentiation. Lethal yellow homozygotes are rare today, while lethal yellow and viable yellow heterozygotes (Ay/a and Avy/a) remain more common. In wild-type mice agouti is only expressed in the skin during hair growth, but these dominant yellow mutations cause it to be expressed in other tissues as well. This ectopic expression of the agouti gene is associated with the yellow obese syndrome, characterized by early onset obesity, hyperinsulinemia and tumorigenesis.
1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide (EDC, EDAC or EDCI) is a water-soluble carbodiimide usually handled as the hydrochloride, which is a white solid. It is typically employed in the 4.0-6.0 pH range. It is generally used as a carboxyl activating agent for the coupling of primary amines to yield amide bonds. While other carbodiimides like dicyclohexylcarbodiimide (DCC) or diisopropylcarbodiimide (DIC) are also employed for this purpose, EDC has the advantage that the urea byproduct formed (often challenging to remove in the case of DCC or DIC) can be washed away from the amide product using dilute acid. Additionally, EDC can also be used to activate phosphate groups in order to form phosphomonoesters and phosphodiesters. Common uses for this carbodiimide include peptide synthesis, protein crosslinking to nucleic acids, but also in the preparation of immunoconjugates. EDC is often used in combination with N-hydroxysuccinimide (NHS) for the immobilisation of large biomolecules. Recent work has also used EDC to assess the structure state of uracil nucleobases in RNA.
Sources: en.wikipedia.org
The histology of ALK-negative ALCL, similar to ALK-positive ALCL, consist of "hallmark" cells that strongly express CD30. Unlike ALK-positive ALCL, however, ALK-negative ALC does not fall into different morphological patterns. The histological of this disease may overlap with and be difficult to distinguish from other CD30-positive T-cell lymphomas or the nodular sclerosis form of Hodgkin lymphoma. Cases in which ALK-negative ALCL is not distinguishable from the latter lymphomas are best diagnosed as peripheral T-cell lymphoma not otherwise specified (PTL, NOS). The histology of ALK-negative ALCL may also overlap with tumors of non–T-cell lineage such as various carcinomas. The differential diagnoses of ambiguous cases may be helped by examining the tumor cells for the expression of certain marker proteins. For example, expression of CD56, MUC1 (also termed EMA for epithelial membrane antigen), and clusterin and strong uniform expression of CD30 support the diagnosis of ALK-negative ALCL over PTL, NOS, while variable CD30 expression and extensive expression of T-cell receptor proteins favor PTCL-NOS over ALK-negative ALCL. Detection of certain gene abnormalities (see next section) may also help distinguishing these diseases.
Isoforms I, III, and VIII are also stimulated by Ca2+/calmodulin. Isoforms V and VI are inhibited by Ca2+ in a calmodulin-independent manner. Isoforms II, IV and IX are stimulated by alpha subunit of the G protein. Isoforms I, V and VI are most clearly inhibited by Gi, while other isoforms show less dual regulation by the inhibitory G protein. Soluble AC (sAC) is not a transmembrane form and is not regulated by G proteins or forskolin, instead acts as a bicarbonate/pH sensor. It is anchored at various locations within the cell and, with phosphodiesterases, forms local cAMP signalling domains. In neurons, calcium-sensitive adenylyl cyclases are located next to calcium ion channels for faster reaction to Ca2+ influx; they are suspected of playing an important role in learning processes. This is supported by the fact that adenylyl cyclases are coincidence detectors, meaning that they are activated only by several different signals occurring together. In peripheral cells and tissues adenylyl cyclases appear to form molecular complexes with specific receptors and other signaling proteins in an isoform-specific manner.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Aerosol mass spectrometry is the application of mass spectrometry to the analysis of the composition of aerosol particles. Aerosol particles are defined as solid and liquid particles suspended in a gas (air), with size range of 3 nm to 100 μm in diameter and are produced from natural and anthropogenic sources, through a variety of different processes that include wind-blown suspension and combustion of fossil fuels and biomass. Analysis of these particles is important owing to their major impacts on global climate change, visibility, regional air pollution and human health. Aerosols are very complex in structure, can contain thousands of different chemical compounds within a single particle, and need to be analysed for both size and chemical composition, in real-time or off-line applications. Off-line mass spectrometry is performed on collected particles, while on-line mass spectrometry is performed on particles introduced in real time.
Two additional amino acids are in some species coded for by codons that are usually interpreted as stop codons: In addition to the specific amino acid codes, placeholders are used in cases where chemical or crystallographic analysis of a peptide or protein cannot conclusively determine the identity of a residue. They are also used to summarize conserved protein sequence motifs. The use of single letters to indicate sets of similar residues is similar to the use of abbreviation codes for degenerate bases.
Sources: en.wikipedia.org
Karl Fischer titration is a standard method for measuring water content in solid and liquid samples. The result helps confirm the expected monohydrate stoichiometry. Loss-on-drying can also indicate moisture but may not distinguish water from other volatile substances.
Creatinine forms through irreversible cyclization and loss of water from creatine, and the rate increases with temperature, moisture, and pH changes. In dry solid form, the reaction is slow. In solution, degradation can become noticeable over time.
A specification typically lists assay range, water content, appearance, identification, and limits for heavy metals, residual solvents, and microbial counts. It may also include particle size distribution or bulk density for handling purposes. These parameters are distinct from any claimed performance effect.
Creatine is the base compound, while creatine monohydrate is a solid crystalline form that contains one water molecule per creatine molecule. Once dissolved, the monohydrate dissociates and releases creatine, which can participate in cellular energy metabolism. The monohydrate is the form most commonly used in research and commercial products.