The short version of melanocortin receptor fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-04-09. Anything still debated is marked as such rather than presented as settled.
Melanotan II is a synthetic cyclic heptapeptide that acts as an agonist at melanocortin receptors. It was designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous peptide involved in pigment production. The analogue carries a lactam bridge that constrains the ring and slows enzymatic breakdown relative to the native hormone. In research literature it appears under several abbreviations, and naming conventions are not fully standardized. Published descriptions usually place it within the broader melanocortin agonist family.
Receptor binding at MC1R on melanocytes raises intracellular cyclic AMP and increases expression of tyrosinase and related enzymes. The downstream result is greater synthesis of eumelanin, the dark pigment, without ultraviolet exposure acting as the trigger. The compound is not selective, however, and also engages MC3R, MC4R and MC5R, which are expressed in the central nervous system and elsewhere. That lack of selectivity is the explanation usually offered for effects reported outside pigmentation, including appetite suppression and nausea. Selectivity remains a central theme in comparative studies of related peptides.
Human data remain limited and mostly short-term. Reports describe small trials and observational accounts rather than large controlled studies, so questions about dose-response relationships and long-term effects on melanocytes stay open. Whether repeated exposure alters naevus behaviour is not settled in the published record. Researchers also note that self-administered use outside clinical settings makes actual exposure difficult to quantify. Statements about efficacy and safety should therefore be read as preliminary rather than established.
Melanotan-2 is a synthetic cyclic heptapeptide designed as a structural analogue of alpha-melanocyte-stimulating hormone, the endogenous tridecapeptide that regulates pigment production. Two modifications distinguish it from the natural hormone: norleucine replaces methionine at the N-terminus, which limits oxidation, and a D-phenylalanine substitution raises receptor affinity. The ring is closed through an aspartate-lysine lactam bridge, giving the molecule a constrained conformation. The free base has a molecular mass near 1024 daltons, and commercial material is usually supplied as an acetate salt. It appears in the literature as a research peptide rather than an approved therapeutic agent.
Receptor studies place melanotan-2 among non-selective melanocortin agonists, binding MC1R, MC3R, MC4R and MC5R rather than a single subtype. Activation of MC1R on cutaneous melanocytes raises tyrosinase activity and shifts pigment synthesis toward eumelanin, which is darker and more photostable than pheomelanin. Central receptors, particularly MC4R, are associated with appetite suppression and with reported effects on sexual function. Because subtype selectivity is low, the same molecule engages pigment, metabolic and vascular pathways at once, and this breadth is a common explanation offered for the range of adverse events described in user reports.
| Property | Value | Notes |
|---|---|---|
| Chemical class | Synthetic cyclic heptapeptide | Melanocortin receptor agonist |
| Molecular formula | C50H69N15O9 | Neutral form, mass near 1024.2 g/mol |
| Primary targets | MC1R, MC3R, MC4R, MC5R | Binding is non-selective across subtypes |
| Related compounds | Alpha-MSH, melanotan I, afamelanotide | Structurally or functionally related peptides |
| Common abbreviations | MT-II, MT-2 | Naming in the literature is not uniform |
Melanotan II is a synthetic cyclic heptapeptide analogue of alpha-melanocyte-stimulating hormone, a naturally occurring peptide involved in pigmentation signalling. Its structure substitutes a lactam bridge between side chains to increase stability relative to the native hormone. The compound is also known by the shorthand MT-II and by several non-proprietary synonyms used in research catalogues. It is not an approved therapeutic product in any major jurisdiction; material sold under this name is typically offered as a laboratory reagent rather than as a medicine.
Activity is attributed to agonism at melanocortin receptors, particularly MC1R and MC4R. Activation of MC1R on melanocytes increases melanin synthesis, which underlies the reported tanning effect. MC4R engagement in the central nervous system is linked to appetite suppression and to effects on sexual arousal reported in early clinical studies. Those studies were small and were not designed to establish efficacy or long-term safety. Receptor selectivity among the melanocortin subtypes is not absolute, which complicates attribution of any effect to a single pathway.
The compound was developed in the late 1980s and 1990s by academic researchers investigating photoprotection. The rationale held that stimulating melanin production might reduce ultraviolet damage to skin and lower skin cancer risk. Early work examined receptor binding, pigment response, and short-term tolerability in small studies. That program did not produce an approved drug, and formal development stalled after early-phase trials. Whether induced pigmentation confers meaningful photoprotection remains an open question.
Outside regulated medicine, melanotan II circulates through online vendors as a research chemical, often marketed for tanning. Products sold this way vary widely in purity, concentration, and labeling accuracy, and independent testing has documented discrepancies. Published reports describe both pigment effects and adverse reactions, including nausea, flushing, and darkening of existing moles. Long-term safety data are sparse, and no large controlled trial has established a risk profile. Questions about cumulative effects on melanocytes remain unresolved in the literature.
Til the Casket Drops (2009) was the final Clipse album before the duo split to make solo material. The breakup was initiated by Malice, who had multiple conversations with Pusha T about quitting the duo; the first time was after a studio session with Rick Rubin. Toward the end of the duo's partnership, their then-manager and various people in their personal lives were arrested on drug charges. One day, when both brothers were to board a plane, Pusha T was unusually late, and Malice worried that he had been arrested; although Pusha T eventually boarded, it was the final straw for Malice, who angrily declared to his brother in front of the other passengers that he was done with the duo. Although the breakup wasn't made public at the time, rumors that the duo was over began when Malice (then named Malicious) changed his stage name to No Malice, converted to Christianity, and started making Christian rap, as opposed to the "coke rap" of Clipse. In 2014, he firmly denied the possibility of a reunion. His attitude had softened by 2016: "I'ma tell you that I learned to never say never, and I don't shut the door on anything. I really don't. In fact, I would like to see Clipse do it. But I just do things differently." The duo appeared together (credited as Clipse) on "Use This Gospel" by Kanye West, from his Christian hip-hop and gospel album Jesus Is King (2019), having also worked on a demo version of "Follow God". Speaking on the reunion, Pusha T said: "I'm the younger brother, man.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
== Oxygen-14 == Oxygen-14 (half-life 70.62 seconds) is the second most stable radioisotope of oxygen, and decays by positron emission to nitrogen-14. Oxygen-14 ion beams are of interest to researchers of proton-rich nuclei; for example, one early experiment at the Facility for Rare Isotope Beams in East Lansing, Michigan, produced a 14O beam by proton bombardment of 14N, using it to determine the absolute strength of the electron capture transition.
Sources: en.wikipedia.org
== Applications == There are numerous applications for quantitative polymerase chain reaction in the laboratory. It is commonly used for both diagnostic and basic research. Uses of the technique in industry include the quantification of microbial load in foods or on vegetable matter, the detection of GMOs (genetically modified organisms) and the quantification and genotyping of human viral pathogens.
Dorothy Anderson, Administrative Officer, Department of Social Security. John Elwyn Anderson. For services to the community, particularly Lifesaving, in South Wales. Royan Stuart Anderson, Constable, Operational Support Unit, British Transport Police. For services to Public Transport. Timothy John Anderson, Sergeant, Derbyshire Constabulary. For services to the Police. Edmund Robert Askey. For services to Tourism in Blackpool, Lancashire. Charles Keith Atkinson. For services to Young People in Nottinghamshire and to Rowing. Elizabeth Atkinson, Member, Northumberland County Council. For services to Local Government. Marjone Oxnard Atkinson. For services to the community on the Pennywell Estate, Sunderland, Tyne and Wear. Peggy Baerlein. For services to the Lister Hospital, Hertfordshire. Beryl Bailey, Support Grade Band 1, Home Office. Peter Edwin Bailey, lately Senior Doorkeeper, House of Lords. Albert John Baker. For services to War Pensions Committees in London. Elsie Evelyn Baker. For services to the Girls' Brigade on Guernsey. Kenneth Walter Ball, lately Honorary Secretary, British Transport Pensioners' Federation. For services to the Railway Industry. Jack Bonner Barlow. For services to Local Councils in the former South Glamorgan and to the community in Sully. Andrew Brown Barr. For services to the Royal Agricultural Benevolent Institution and to the Essex Agricultural Society. Dennis Gordon Bartholomew. For services to the community in Whiston, South Yorkshire. Haydn Sydney Bateman, Auxiliary Coastguard-in-charge, Her Majesty's Coastguard, St Govans, Dyfed.
Spironolactone may be more effective than birth-control pills in the treatment of acne, and the combination of spironolactone with a birth-control pill may have greater effectiveness for acne than either alone. In addition, some clinical research has found that flutamide is more effective than spironolactone in the treatment of acne. In one study, flutamide decreased acne scores by 80% within 3 months, whereas spironolactone decreased symptoms by only 40% in the same period. However, the use of flutamide for acne is limited by its liver toxicity. Bicalutamide is a potential alternative to flutamide for acne as well. Spironolactone can be considered as a first-line treatment for acne in those who have failed other standard treatments such as topical therapies and under certain other circumstances, although this is controversial due to the side effects of spironolactone and its teratogenicity. Insufficient clinical evidence exists to compare the effectiveness of spironolactone with other antiandrogens for female-pattern hair loss. The effectiveness of spironolactone in the treatment of both acne and hirsutism appears to be dose-dependent, with higher doses being more effective than lower doses. Higher doses also have greater side effects, such as menstrual irregularities.
Sources: en.wikipedia.org
It is a synthetic cyclic heptapeptide and a non-selective melanocortin receptor agonist. Structurally it is modelled on alpha-melanocyte-stimulating hormone, a peptide that occurs naturally in the body.
Activation of MC1R increases pigment synthesis independently of ultraviolet exposure, which is the mechanism usually cited for darkening without sun exposure. Ultraviolet light still influences skin response through separate biological pathways.
Because the peptide binds several melanocortin receptor subtypes, its effects are not confined to pigmentation. This complicates interpretation of both intended and unintended outcomes reported in studies.
No regulatory agency has authorised melanotan-2 as a medicine for any indication. It circulates mainly as a research chemical or through unregulated channels. As a result, identity, purity and content are not independently guaranteed.