The short version of creatine fits in a sentence. The long version — which is the one that helps — is below.
Reviewed 2026-01-21. Anything still debated is marked as such rather than presented as settled.
Recommended storage usually involves a sealed container kept at room temperature, away from direct sunlight and moisture. High humidity can cause caking, which changes flow properties and may complicate accurate weighing. Repeated opening of containers exposes the powder to air and moisture, so smaller aliquots can reduce handling effects. Storage temperature ranges are not absolute requirements; they reflect conditions that slow degradation and preserve consistent physical characteristics. Clean, dry tools help prevent contamination during sampling.
Identity and purity are commonly assessed by high-performance liquid chromatography, often with ultraviolet detection, and by spectroscopic techniques such as infrared or nuclear magnetic resonance. These methods can distinguish creatine from creatinine and detect related impurities. Moisture content may be measured by Karl Fischer titration or loss on drying. Particle size, bulk density, and heavy metal limits are additional quality parameters. Not every product is tested by every method, so specifications depend on the intended use and regulatory framework.
Solid creatine monohydrate is generally stable when kept dry and protected from extremes of heat and humidity. In the presence of moisture, it can gradually convert to creatinine, a cyclic dehydration product that has little value for phosphocreatine synthesis. Elevated temperatures and acidic conditions accelerate this conversion in solution. Because the reaction is slow in cool, dry storage, typical shelf lives are measured in years rather than weeks. Packaging that limits moisture and oxygen exposure helps maintain purity.
Several creatine forms are sold, including monohydrate, anhydrous, hydrochloride, nitrate, citrate, and blends. Once dissolved, these forms deliver creatine, but they differ in molar mass, solubility, counterions, and water content. Creatine monohydrate has the largest body of published human data among these forms. Questions remain about whether any alternative form offers meaningful advantages in absorption, tolerability, or tissue uptake under practical conditions. The hydrate form's lower creatine content by mass is a compositional fact, not a statement about effectiveness.
Creatine monohydrate is a crystalline compound formed when one molecule of creatine associates with one molecule of water in the solid lattice. Its molecular formula is C4H11N3O3, and its molar mass is about 149.15 grams per mole. The material appears as a white, odorless powder that dissolves sparingly in water at room temperature. The monohydrate designation distinguishes it from anhydrous creatine, which lacks the bound water and has a lower molar mass. This hydrate is the most common commercial form of creatine used in nutritional and research settings.
| Property | Value | Notes |
|---|---|---|
| Typical storage temperature | 15–25 °C | Cool, dry, sealed conditions slow conversion to creatinine. |
| Moisture sensitivity | Moderate | Absorbs water from humid air, which can cause caking. |
| Primary purity method | HPLC-UV | Separates creatine from creatinine and related impurities. |
| Moisture method | Karl Fischer titration | Measures water content; loss on drying is an alternative. |
| Degradation product | Creatinine | Forms by dehydration, especially in solution or humid heat. |
Creatine monohydrate is sold as a dietary ingredient in some countries and as a food supplement in others. Regulatory frameworks vary, so purity limits, labeling rules, and permitted claims are not globally uniform. In the United States, it falls under dietary supplement rules, whereas the European Union treats it as a food supplement ingredient. Pharmacopeial monographs, where they exist, can provide public quality standards, but not every product is required to meet them. Questions about long-term effects and patterns of use remain areas of active study rather than settled regulatory findings.
Solid creatine monohydrate is generally stable when kept cool and dry, but it can hydrolyze to creatinine over time. Moisture, heat, and acidic conditions accelerate this conversion, which reduces assay values and changes the material's properties. Creatinine is a cyclic dehydration product that is also a normal human metabolite, so its presence in a sample is not necessarily a health concern by itself. In quality testing, creatinine is monitored as a marker of degradation and purity.
Commercial creatine products appear in several forms, including monohydrate, hydrochloride, citrate, nitrate, and ethyl ester. Creatine monohydrate is the most studied form and serves as a reference material in comparative research. Different forms vary in solubility, pH, and water content, but they share creatine as the active moiety after dissolution. Claims that one form is uniformly superior remain debated, and study designs often differ in population, exercise protocol, and outcome measures. Purity and hydration state are central to interpreting product labels.
Creatine monohydrate is the hydrated form of creatine, a nitrogen-containing organic acid involved in cellular energy transfer. Its molecular formula is C4H11N3O3, and it consists of creatine plus one water molecule in the crystal lattice. The anhydrous base, creatine, has the formula C4H9N3O2. The compound appears as a white, odorless, crystalline powder and is classified as a guanidine derivative. It is distinct from creatinine, a breakdown product measured in clinical chemistry.
In animals, creatine is synthesized mainly in liver, kidney, and pancreas from arginine, glycine, and methionine. The first committed step transfers a guanidino group from arginine to glycine, forming guanidinoacetate. Subsequent methylation by S-adenosylmethionine yields creatine. Dietary sources include meat and fish; endogenous synthesis supplies part of the body pool. Most creatine is stored in skeletal muscle, where it is converted to phosphocreatine and participates in rapid regeneration of adenosine triphosphate during short, intense activity.
Commercial creatine monohydrate is typically a white to off-white powder with low odor. It is commonly sold as a fine powder, micronized powder, or larger crystals, but these are physical forms of the same chemical. Purity grades vary, and products may contain small amounts of related substances such as creatinine, dicyandiamide, or moisture. The monohydrate is often selected for supplements and research because its production is well established and its behavior in water is predictable. Analytical certificates usually report assay, loss on drying, and heavy metals.
Creatine monohydrate is a crystalline compound formed from creatine and one water molecule in its solid lattice. Creatine itself is a nitrogen-containing organic acid involved in energy transfer in muscle and other tissues. The monohydrate form is the most common solid form used in research and commercial products because it is stable and easy to handle. The term "monohydrate" refers to the fixed one-to-one ratio of water to creatine in the crystal, not to moisture content. This distinction matters when comparing labels or calculating creatine content.
In chemical terms, creatine monohydrate is often described as N-(aminoiminomethyl)-N-methylglycine monohydrate, though nomenclature varies. Its solid state consists of zwitterionic creatine molecules linked with water through hydrogen bonding. The compound dissolves in water, but dissolution rate depends on particle size, temperature, and agitation. Once dissolved, the hydrate water becomes part of the solvent, leaving free creatine in solution. The monohydrate is not the same as creatine anhydrous, which lacks the water of crystallization and has a higher creatine fraction by mass.
Regulatory status varies by country. In the United States, creatine monohydrate is sold as a dietary supplement ingredient, while in the European Union it is placed on the market as a food supplement component. Some jurisdictions have established purity monographs or permitted health claims, while others treat it as a novel food or require notification. Product labels may state the amount of creatine monohydrate or the equivalent creatine content, and the two figures can differ. Independent testing programs sometimes check identity, potency, and contaminant limits.
Creatine monohydrate is stable under dry, cool conditions but can degrade when exposed to moisture and heat. In solution, it undergoes hydrolysis to creatinine, a cyclic derivative with little role in phosphagen energy transfer. The rate of conversion increases with temperature, storage time, and acidic or alkaline pH. Solid material kept in a sealed container at room temperature generally retains its composition for extended periods. Moisture uptake is a primary concern because it can accelerate breakdown and caking.
Analytical laboratories commonly use high-performance liquid chromatography to separate creatine from creatinine and related impurities. Ion chromatography, nuclear magnetic resonance, and titration assays can also quantify the compound. Water content is measured by Karl Fischer titration or loss on drying, because the monohydrate has a defined theoretical water fraction. Particle size, bulk density, and flowability are physical properties that affect blending and capsule filling. These measurements support quality control and help verify that a lot matches its specification.
While it is usually considered that the driver has the responsibility when collisions occur, vehicle can also contribute to collisions, up to 3% to 5% of crashes. Two kinds of programs exist: new car assessment program for new cars, and vehicle inspections for other ones. A New Car Assessment Program is a government or institutional car safety program tasked with evaluating new car designs for performance against various safety threats. Two well known NCAP are United States New Car Assessment Program since 1978 and European New Car Assessment Programme since 1997.
Homopolymers of amino acids (such as polylysine) can adopt α-helical structure at low temperature that is "melted out" at high temperatures. This helix–coil transition was once thought to be analogous to protein denaturation. The statistical mechanics of this transition can be modeled using an elegant transfer matrix method, characterized by two parameters: the propensity to initiate a helix and the propensity to extend a helix.
TNF is a cytokine produced mainly by activated macrophages, and is the major extrinsic mediator of apoptosis. Most cells in the human body have two receptors for TNF: TNFR1 and TNFR2. The binding of TNF to TNFR1 has been shown to initiate the pathway that leads to caspase activation via the intermediate membrane proteins TNF receptor-associated death domain (TRADD) and Fas-associated death domain protein (FADD). cIAP1/2 can inhibit TNF signaling by binding to TRAF2. FLIP inhibits the activation of caspase-8. Binding of this receptor can also indirectly lead to the activation of transcription factors involved in cell survival and inflammatory responses. However, signalling through TNFR1 might also induce apoptosis in a caspase-independent manner. The link between TNF and apoptosis shows why an abnormal production of TNF plays a fundamental role in several human diseases, especially in autoimmune diseases. The TNF receptor superfamily also includes death receptors (DRs), such as DR4 and DR5. These receptors bind to the protein TRAIL and mediate apoptosis. Apoptosis is known to be one of the primary mechanisms of targeted cancer therapy. Luminescent iridium complex-peptide hybrids (IPHs) have recently been designed, which mimic TRAIL and bind to death receptors on cancer cells, thereby inducing their apoptosis.
The circadian oscillators in eukaryotes that have been studied function using a negative feedback loop in which proteins inhibit their own transcription in a cycle that takes approximately 24 hours. This is known as a transcription-translation-derived oscillator (TTO).(2) Without a nucleus, prokaryotic cells must have a different mechanism of keeping circadian time. In 1998, Ishiura et al. determined that the KaiABC protein complex was responsible for the circadian negative feedback loop in Synechococcus by mapping 19 clock mutants to the genes for these three proteins.(3) An experiment by Nakajima et al., in 2005, was able to demonstrate the circadian oscillation of the Synechococcus KaiABC complex in vitro. They did this by adding KaiA, KaiB, KaiC, and ATP into a test tube in the approximate ratio recorded in vivo. They then measured the levels of KaiC phosphorylation and found that it demonstrated circadian rhythmicity for three cycles without damping. This cycle was also temperature compensating. They also tested incubating mutant KaiC protein with KaiA, KaiB, and ATP. They found that the period of KaiC phosphorylation matched the intrinsic period of the cyanobacterium with the corresponding mutant genome. These results led them to conclude that KaiC phosphorylation is the basis for circadian rhythm generation in Synechococcus. (2)
Enzymes incur catalysis by binding more strongly to transition states than substrates and products. At the catalytic binding site, several different interactions may act upon the substrate. These range from electric catalysis, acid and base catalysis, covalent catalysis, and metal ion catalysis. These interactions decrease the activation energy of a chemical reaction by providing favorable interactions to stabilize the high energy molecule. Enzyme binding allows for closer proximity and exclusion of substances irrelevant to the reaction. Side reactions are also discouraged by this specific binding. Types of enzymes that can perform these actions include oxidoreductases, transferases, hydrolases, lyases, isomerases, and ligases. For instance, the transferase hexokinase catalyzes the phosphorylation of glucose to make glucose-6-phosphate. Active site residues of hexokinase allow for stabilization of the glucose molecule in the active site and spur the onset of an alternative pathway of favorable interactions, decreasing the activation energy.
Sources: en.wikipedia.org
There are several national and international bioanalytical organisations active throughout the world. Often they are part of a bigger organisation, e.g. Bioanalytical Focus Group and Ligand Binding Assay Bioanalytical Focus Group, which are both within the American Association of Pharmaceutical Scientists (AAPS) and FABIAN, a working group of the Analytical Chemistry Section of the Royal Netherlands Chemical Society. The European Bioanalysis Forum (EBF), on the other hand, is independent of any larger society or association.
The American Society for Quality (ASQ), formerly the American Society for Quality Control (ASQC), is a society of quality professionals, with more than 30,000 members, in more than 140 countries. ASQC was established on 16 February 1946 by 253 members in Milwaukee, Wisconsin, with George D. Edwards as its first president. The organization was first created as a way for quality experts and manufacturers to sustain quality-improvement techniques used during World War II. In 1948, ASQC's Code of Ethics established standards for members to conduct their activities and business. Business writer Armand V. Feigenbaum served as president of the society in 1961–63. In 1997, the members of the organization voted to change its name from "American Society for Quality Control" to "American Society for Quality".
Albiglutide (trade names Eperzan in Europe and Tanzeum in the US) is a glucagon-like peptide-1 agonist (GLP-1 agonist) drug marketed by GlaxoSmithKline (GSK) for treatment of type 2 diabetes. In 2017 GSK announced Albiglutide's withdrawal from the worldwide market for economic reasons, and remaining stocks in the supply chain were effectively depleted by 2018. Albiglutide was used for the treatment of type 2 diabetes in adults. It can be used alone (if metformin therapy is ineffective or not tolerated) or in combination with other antidiabetic drugs, including insulins. According to a 2015 analysis, albiglutide is less effective than other GLP-1 agonists for lowering glycated hemoglobin (HbA1c, an indicator for long-term blood glucose control) and weight loss. It also seems to have fewer side effects than most other drugs of this class, except for reactions at the injection site which are more common under albiglutide than, for example, under liraglutide.
Actovegin is a highly filtered extract obtained from calf blood which enhances aerobic oxidation in mammals. This improves absorption of glucose and oxygen uptake in tissue, which may enhance physical performance and stamina. Local utilisation is allowed in countries like Canada and Sweden. Doctors like Hans-Wilhelm Müller-Wohlfahrt and Richard Steadman think Actovegin should be allowed in general. Others think there is not enough research, and persons from the World Anti-Doping Agency like Olivier Rabin is sceptical that it is having more than a placebo effect. Actovegin made headlines from 2009 to 2011 when Canadian sports doctor Anthony Galea was charged with drug smuggling, conspiring to lie to federal agents, unlawful possession with intent to distribute and practising medicine without a licence in the United States. Galea pleaded guilty of bringing misbranded and unapproved drugs, including Nutropin, a human growth hormone, and Actovegin, into the United States. The discipline committee for the College of Physicians and Surgeons of Ontario (CPSO) suspended Galeas license for 9 months for professional misconduct.
AAA proteases use the energy from ATP hydrolysis to translocate a protein inside the proteasome for degradation. Cdc48p/p97 functions as a hexameric AAA+ ATPase that provides the mechanical force necessary for substrate dislocation. Its activity is tightly regulated by ATP binding and hydrolysis, which induce conformational changes required for protein unfolding and extraction. The HbYX motif plays a crucial role in regulating this process by mediating interactions between Cdc48p/p97 and downstream effectors such as the 20S proteasome or specific cofactors (e.g., Ufd1/Npl4). This interaction facilitates substrate transfer from Cdc48p/p97 to the proteasome, ensuring efficient protein degradation. Given its pivotal role in protein homeostasis, Cdc48p/p97 has been implicated in a wide range of cellular processes beyond ERAD, including autophagy, mitochondrial quality control, and DNA repair. The dysregulation of its function, particularly through mutations affecting the ATPase domain or HbYX-mediated interactions, has been linked to neurodegenerative diseases and cancer.
Sources: en.wikipedia.org
This term has become very popular and commonly used in practice. But the appropriate expression is "enantioselective chromatography". Chiral chromatography has advanced to turn into the most preferred technique for the determination of enantiomeric purity as well as separation of pure enantiomers both on analytical and preparative scale. Chiral chromatographic assay is the first step in any study pertaining to enantioselective synthesis or separation. This includes the use of techniques viz. gas chromatography (GC), high performance liquid chromatography (HPLC), chiral supercritical fluid chromatography (SFC), capillary electrophoresis (CE) and thin-layer chromatography (TLC). The result of a literature survey done identifies HPLC-based chiral assays as the most dominating technology in use. An overview of various analytical methods engaged for chiral separation and analysis are listed in the table.
In the competition of bacterial cells and host cells with the antimicrobial peptides, antimicrobial peptides will preferentially interact with the bacterial cell to the mammalian cells, which enables them to kill microorganisms without being significantly toxic to mammalian cells. With regard to cancer cells, they themselves also secrete human antimicrobial peptides including defensin, and in some cases, they are reported to be more resistant than the surrounding normal cells. Therefore, we cannot conclude that selectivity is always high against cancer cells.
The word analgesic derives from Greek an- (ἀν-, "without"), álgos (ἄλγος, "pain"), and -ikos (-ικος, forming adjectives). Such drugs were usually known as "anodynes" before the 20th century. Analgesics are typically classified based on their mechanism of action. Paracetamol, also known as acetaminophen, is a medication used to treat pain and fever. It is typically used for mild to moderate pain. In combination with opioid pain medication, paracetamol is now used for more severe pain such as cancer pain and after surgery. It is typically used either by mouth or rectally but is also available intravenously. Effects last between two and four hours. Paracetamol is classified as a mild analgesic, and is generally safe at recommended doses. Nonsteroidal anti-inflammatory drugs (NSAIDs) are a drug class that groups together drugs that decrease pain and lower fever, and, in higher doses, decrease inflammation. The most prominent members of this group of drugs—aspirin, ibuprofen, naproxen, and diclofenac—are all available over the counter in most countries.
Data from high-throughput chromosome conformation capture experiments, such as Hi-C (experiment) and ChIA-PET, can provide information on the three-dimensional structure and nuclear organization of chromatin. Bioinformatic challenges in this field include partitioning the genome into domains, such as Topologically Associating Domains (TADs), that are organised together in three-dimensional space. Finding the structure of proteins is an important application of bioinformatics. The Critical Assessment of Protein Structure Prediction (CASP) is an open competition where worldwide research groups submit protein models for evaluating unknown protein models.
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Sources: en.wikipedia.org
Solid product can remain within specification for years when stored dry and sealed, but expiration dates reflect manufacturer testing and regulatory conventions. Moisture and heat increase conversion to creatinine, so storage conditions matter more than the printed date alone. Degradation is gradual and can be monitored by purity testing.
Purity is typically evaluated by chromatographic separation with ultraviolet detection, sometimes supported by spectroscopic identity tests. Moisture and creatinine content are common quality parameters. Results depend on the analytical method, sample preparation, and specification limits.
Clumping occurs when powder absorbs moisture, causing particles to stick together. Humidity, temperature changes, and repeated container opening promote this effect. Clumps do not necessarily indicate chemical degradation, but they can affect weighing and mixing.
It is the hydrated crystalline form of creatine, containing one bound water molecule per creatine unit. The compound is commonly used as a nutritional ingredient and as a research material.